PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 615aa    MW: 67218.4 Da    PI: 5.1933
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1422e-13165224362
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e ++  r+++NRe+A+ sRqRKk ++eeLeekvk+L +  ++L  +++    e a+l+++
  XP_013636928.1 165 EKRKRARLIRNRESAQLSRQRKKHYVEELEEKVKSLHSCITDLNGKISYFMAENATLRQQ 224
                     44556699************************************9999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-16162227IPR004827Basic-leucine zipper domain
PfamPF001707.0E-12165225IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082165225IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-16167225No hitNo description
SuperFamilySSF579594.78E-12167225No hitNo description
CDDcd147046.38E-21168219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MAESITEEPP PPEFDPISTP PFAQFHNPSS DQTPIGELMS DLGFPIDADF ELTFDGMEDL  60
YLPAEDETFL LPDNASNQEQ FGDFTSESDD ERTSDQPTPL SSQGSDNCGS DVSEAVDQKV  120
KVEEASATKR KKEDTSDESR SSKFMRSGEE SAVVTGEEEE EEEDEKRKRA RLIRNRESAQ  180
LSRQRKKHYV EELEEKVKSL HSCITDLNGK ISYFMAENAT LRQQLGPPPP YPPMAYPWMH  240
CPPYMVKQQG GGQVPLIPIP RLKPQNPVKA KSKKSEAKTK KVASISFLGL VFCLFLFGAL  300
APVVNVNYGG ISGGVFYGSY RSNYVTDQVY NQHRNRILDT SRSNERDSAT ESSVPPGNGS  360
EPLVASLFVP RNDKLVKIDG NLIINSILAS EKALASESNE RKADGVVPKD HSLALPLPDV  420
GMIEDMAKHL VRTKAEKQKA LSSGSAETLK DSIKTKAASG EMQQWFREGV AGPMFSSGMC  480
TEVFQFDVSS TSGAIIPASA ATNVPSEHSK NATVTQRQKN RRTLRGLAIP LPGSDFNFTK  540
GHQRNSSSKE IKAASSMVVS VLVDPREGGD GDIDGMIGGP KSLSRVFVVV LQDSAKYVTY  600
SCVLPRPGAP HLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636928.10.0PREDICTED: bZIP transcription factor 17
RefseqXP_013636929.10.0PREDICTED: bZIP transcription factor 17
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3C5J60.0A0A0D3C5J6_BRAOL; Uncharacterized protein
STRINGBra016959.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein